Home > Product > Antimicrobial Peptides > Styelin E

Antimicrobial Peptides

CAT#
AF2110
Sequence
GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL
Host Chemicals
Styela clava
Length
32
Activity
Antimicrobial
SwissProt ID
O18496
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.