Home > Product > Catalog Peptides > Others > Submaxillary gland androgen-regulated protein 3B

Others

Submaxillary gland androgen-regulated protein 3B

[Price Inquiry]
CAT#
S18001
Sequence
QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP
Modifications
Pyrrolidone carboxylic acid(1)
Length
57
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.