Home > Product > Antimicrobial Peptides > Subtilomycin

Antimicrobial Peptides

Subtilomycin

[Price Inquiry]
CAT#
AF2160
Sequence
TWATIGKTIVQSVKKCRTFTCGCSLGSCSNCN
Host Chemicals
Bacillus subtilis MMA7
Length
32
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.