Home > Product > Antimicrobial Peptides > Subtilosin A1

Antimicrobial Peptides

Subtilosin A1

[Price Inquiry]
CAT#
AF2451
Sequence
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
Host Chemicals
Bacillus subtilis
Length
35
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.