Home > Product > Antimicrobial Peptides > Sushi peptide 3

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Sushi peptide 3

[Price Inquiry]
CAT#
AF2364
Sequence
HAEHKVKIGVEQKYGQFPQGTEVTYTCSGNYFLM
Host Chemicals
Protein-derived peptide
Length
34
Activity
Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.