Home > Product > Antimicrobial Peptides > T07C4.4

Antimicrobial Peptides

CAT#
AF2448
Sequence
MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF
Host Chemicals
Caenorhabditis elegans
Length
35
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.