Home > Product > Catalog Peptides > Others > γ - TAC4 (30 - 61) - -NH2

Others

γ - TAC4 (30 - 61) - -NH2

[Price Inquiry]
CAT#
T01022
Sequence
TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.