Home > Product > Catalog Peptides > Others > γ - TAC4 (30 - 61) - -NH2

Others

γ - TAC4 (30 - 61) - -NH2

Price Inquiry
CAT#
T01022
Sequence
TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.