Home > Product > Antimicrobial Peptides > Tachystatin-A 1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Tachystatin-A 1

[Price Inquiry]
CAT#
AF3128
Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
Host Chemicals
Tachypleus tridentatus
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
P0C1Z7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.