Keywords Search Google Search Search

Tachystatin-A 1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3128
Sequence	YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF126	Hyposin-J1	Inquiry
AF003	EP2	Inquiry
AF3164	Ee-CBP	Inquiry
AF132	Halictine 1	Inquiry
AF2986	Beta-defensin 118	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of fertirelin acetate in prostate cancer and other diseases

Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...

Delcasertib: A Novel δ-Protein Kinase C Inhibitor

Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...

Function of D15 As An Endocytosis Inhibitor

The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Tachypleus tridentatus
Length	44
SwissProt ID	P0C1Z7
Modifications	Disulfide bond(3)