Home > Product > Antimicrobial Peptides > Tachystatin-C

Antimicrobial Peptides

Tachystatin-C

[Price Inquiry]
CAT#
AF2873
Sequence
DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR
Host Chemicals
Tachypleus tridentatus
Length
41
Activity
Antibacterial, Antifungal
SwissProt ID
P0C200
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.