Home > Product > Antimicrobial Peptides > Tachystatin C

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Tachystatin C

[Price Inquiry]
CAT#
AF2874
Sequence
DYDWSLRGPPKCATYGQKCRTWSPRNCCWNLRCKAFRCRPR
Host Chemicals
horseshoe crabs, Tachypleus tridentatus
Length
41
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.