Home > Product > Antimicrobial Peptides > Termicin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2477
Sequence
ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
Host Chemicals
Pseudacanthotermes spiniger
Length
36
Activity
Antibacterial, Antifungal
SwissProt ID
P82321
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.