Home > Product > Antimicrobial Peptides > Termicin

Antimicrobial Peptides

CAT#
AF2477
Sequence
ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
Host Chemicals
Pseudacanthotermes spiniger
Length
36
Activity
Antibacterial, Antifungal
SwissProt ID
P82321

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.