Home > Product > Antimicrobial Peptides > Thaumatin-like protein

Antimicrobial Peptides

Thaumatin-like protein

[Price Inquiry]
CAT#
AF1876
Sequence
ANFEIVNNCPYTVWAAASPGGGRRLDRGQT
Host Chemicals
Phaseolus vulgaris
Length
30
Activity
Antifungal
SwissProt ID
P83959
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.