Home > Product > Catalog Peptides > Others > [Thr30]-Neuropeptide Y, human

Others

[Thr30]-Neuropeptide Y, human

Price Inquiry
CAT#
N05025
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2
M.W/Mr.
4259.7
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.