Home > Product > Catalog Peptides > Others > TIP-39

Others

CAT#
P03042
Sequence
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
M.W/Mr.
4504.3
Molecular Formula
C202H325N61O54S
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.