Keywords Search Google Search Search

TIP-39

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03042
M.F/Formula	C202H325N61O54S
M.W/Mr.	4504.3
Sequence	SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

CAT#	Product Name	Inquiry
P03014	(Tyr43)-pTH (43-68) (human)	Inquiry
P03054	Hypercalcemia Malignancy Factor (7-34), amide, human	Inquiry
P03033	(Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat)	Inquiry
P03011	pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat)	Inquiry
P03037	(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Bombesin and Bombesin-like peptides

Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

Trimetazidine and related diseases

Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...

PAC-113: A clinically active antimicrobial peptide

PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...

Function of M871 as a Galanin GAL2 Receptor Antagonist

Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: