Home > Product > Antimicrobial Peptides > ToAMP4

Antimicrobial Peptides

CAT#
AF2885
Sequence
GYGDGCYSEDDLSVCCKKKFKVIGKCFKSVRECQNSGCKYH
Host Chemicals
flowers, Taraxacum officinale
Length
41
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.