Home > Product > Antimicrobial Peptides > TPA_exp: DEFB103-like protein

Antimicrobial Peptides

TPA_exp: DEFB103-like protein

[Price Inquiry]
CAT#
AF2532
Sequence
QKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCR
Host Chemicals
Papio anubis
Length
36
Activity
Antibacterial, Antifungal, Antiviral
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.