Home > Product > Antimicrobial Peptides > TPA_exp: EP2E protein

Antimicrobial Peptides

TPA_exp: EP2E protein

[Price Inquiry]
CAT#
AF2457
Sequence
RDVICLMQHGTCRLFFCHSGEKKSEICSDPWNRCC
Host Chemicals
Sus scrofa
Length
35
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.