Antimicrobial Peptides

CAT#
AF3228
Sequence
QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC
Host Chemicals
tomato, Lycopersicon esculentum
Length
47
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.