Home > Product > Antimicrobial Peptides > Tracheal antimicrobial peptide, partial

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Tracheal antimicrobial peptide, partial

[Price Inquiry]
CAT#
AF2400
Sequence
VSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCR
Host Chemicals
Bos taurus
Length
34
Activity
Antimicrobial
SwissProt ID
D9J275
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.