Home > Product > Antimicrobial Peptides > Tracheal antimicrobial peptide precursor

Antimicrobial Peptides

Tracheal antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2743
Sequence
NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
Host Chemicals
Bos taurus
Length
38
Activity
Antibacterial, Antifungal
SwissProt ID
P25068
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.