β-Amyloid (1-42), (1-40), (1-46) and Fragments

[Trp4]-beta-Amyloid (1-40)

[Price Inquiry]
CAT#
A13284
Sequence
DAEWRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4368.9
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.