Home > Product > Catalog Peptides > Others > Tuberoinfundibular peptide of 41 residues,bovine

Others

Tuberoinfundibular peptide of 41 residues,bovine

[Price Inquiry]
CAT#
T25004
Sequence
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.