Tuberoinfundibular peptide of 41 residues,bovine

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	T25004
Sequence	SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

CAT#	Product Name	Inquiry
C08126	KM-HN-1(65-74)	Inquiry
X03613	PM_10980199	Inquiry
X04752	PM_11807753	Inquiry
X14668	PM_8383967	Inquiry
X08284	PM_1665735	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

Purotoxin 1, a highly selective blocker of Р2Х3 receptors

Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...

Function of teriparatide in the treatment of osteoporosis

Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...

Function of KYL Solution on the Cold Preservation of Liver

Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: