Tuberoinfundibular peptide of 40 residues,mouse

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	T25003
Sequence	SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP

CAT#	Product Name	Inquiry
X02011	PH1VV018_71	Inquiry
X15265	PM_8741992	Inquiry
X07038	PM_15390258	Inquiry
X17107	PM_9873503	Inquiry
X09946	PM_19266197	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Glucagon like peptide-1 (GLP-1)

GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...

The Introduction of Orexin A

Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...

Basic information of Somatostatin

The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...

Compstatin: a pharmaceutical inhibitor of complement

Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: