Home > Product > Catalog Peptides > Others > Turritoxin GpIAb

Others

Turritoxin GpIAb

[Price Inquiry]
CAT#
T26002
Sequence
SYAMSHMPMSRMGRKMYQNYMYRRMQATKMMQYH
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.