Home > Product > Catalog Peptides > Others > Tyr-CRF (ovine)

Others

Tyr-CRF (ovine)

[Price Inquiry]
CAT#
C29017
Sequence
YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
M.W/Mr.
4833.55
Molecular Formula
C214H348N60O65S
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.