Home > Product > Catalog Peptides > Others > Tyr-CRF (ovine)

Others

Tyr-CRF (ovine)

Price Inquiry
CAT#
C29017
Sequence
YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
M.W/Mr.
4833.55
Molecular Formula
C214H348N60O65S
Length
42

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.