Keywords Search Google Search Search

Tyr-Proinsulin C-Peptide (55-89) (human)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	C31011
M.F/Formula	C162H268N50O54
M.W/Mr.	3780.21
Sequence	YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR

CAT#	Product Name	Inquiry
C31009	Proinsulin C-Peptide (31-63), porcine	Inquiry
C31001	C-peptide (57-87), human	Inquiry
C31007	C-Peptide-1, rat	Inquiry
C31012	([D8]Val7·10)-C-Peptide (human)	Inquiry
C31005	[Tyr0]-C-Peptide, human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

The mechanism of R18 on 14-3-3 protein

R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Montirelin: a thyrotropin-releasing hormone analogue

Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: