Home > Product > Catalog Peptides > Insulin C-Peptides > Tyr-Proinsulin C-Peptide (55-89) (human)

Insulin C-Peptides

Tyr-Proinsulin C-Peptide (55-89) (human)

[Price Inquiry]
CAT#
C31011
Sequence
YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR
M.W/Mr.
3780.21
Molecular Formula
C162H268N50O54
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.