CAT# | C31011 |
M.F/Formula | C162H268N50O54 |
M.W/Mr. | 3780.21 |
Sequence | YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR |
Length | 36 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C31009 | Proinsulin C-Peptide (31-63), porcine | Inquiry | ||
C31001 | C-peptide (57-87), human | Inquiry | ||
C31007 | C-Peptide-1, rat | Inquiry | ||
C31012 | ([D8]Val7·10)-C-Peptide (human) | Inquiry | ||
C31005 | [Tyr0]-C-Peptide, human | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. Emu oil in combination with other active ingredients for treating skin imperfections
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...