Home > Product > Catalog Peptides > Others > (Tyr0)-BNP-32 (human)

Others

(Tyr0)-BNP-32 (human)

[Price Inquiry]
CAT#
B10003
Sequence
YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
M.W/Mr.
3627.26
Molecular Formula
C152H253N51O44S4
Modifications
disulfide
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.