Home > Product > Catalog Peptides > Others > (Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat)

Others

(Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat)

Price Inquiry
CAT#
P03033
Sequence
YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
M.W/Mr.
4180.79
Molecular Formula
C189H296N58O50
Length
35

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.