Home > Product > Catalog Peptides > Others > (Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat)

Others

warning All products are for research use only. Not for human use.

(Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat)

[Price Inquiry]
CAT#
P03033
Sequence
YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
M.W/Mr.
4180.79
Molecular Formula
C189H296N58O50
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.