Home > Product > Catalog Peptides > Others > [Tyr1] Parathyroid Hormone (1-34), human

Others

warning All products are for research use only. Not for human use.

[Tyr1] Parathyroid Hormone (1-34), human

[Price Inquiry]
CAT#
P03035
Sequence
YVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
M.W/Mr.
4193.9
Molecular Formula
C187H295N55O51S2
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.