Home > Product > Catalog Peptides > Others > [Tyr34] Parathyroid Hormone (7-34), amide, bovine

Others

[Tyr34] Parathyroid Hormone (7-34), amide, bovine

Price Inquiry
CAT#
P03017
Sequence
FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2
M.W/Mr.
3496.1
Molecular Formula
C156H244N48O40S2
Length
28

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.