Home > Product > Catalog Peptides > Others > [Tyr34] Parathyroid Hormone (7-34), amide, bovine

Others

warning All products are for research use only. Not for human use.

[Tyr34] Parathyroid Hormone (7-34), amide, bovine

[Price Inquiry]
CAT#
P03017
Sequence
FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2
M.W/Mr.
3496.1
Molecular Formula
C156H244N48O40S2
Length
28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.