Home > Product > Catalog Peptides > Others > (Tyr36)-pTH-Related Protein (1-36) amide (chicken)

Others

warning All products are for research use only. Not for human use.

(Tyr36)-pTH-Related Protein (1-36) amide (chicken)

[Price Inquiry]
CAT#
P03034
Sequence
AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2
M.W/Mr.
4191.76
Molecular Formula
C184H301N57O55
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.