Home > Product > Catalog Peptides > Others > (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Others

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

[Price Inquiry]
CAT#
P03036
Sequence
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
M.W/Mr.
4309.91
Molecular Formula
C194H303N59O53
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.