Home > Product > Catalog Peptides > Others > (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Others

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Price Inquiry
CAT#
P03036
Sequence
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
M.W/Mr.
4309.91
Molecular Formula
C194H303N59O53
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.