Home > Product > Antimicrobial Peptides > U-theraphotoxin-Aju1a

Antimicrobial Peptides

U-theraphotoxin-Aju1a

[Price Inquiry]
CAT#
AF2700
Sequence
FTCAISCDIKVNGKPCKGSGEKKCSGGWSCKFNVCVKV
Host Chemicals
Avicularia juruensis
Length
38
Activity
Antifungal
SwissProt ID
B3EWQ0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.