Home > Product > Catalog Peptides > Others > U2-sicaritoxin-Li1a

Others

U2-sicaritoxin-Li1a

[Price Inquiry]
CAT#
S14003
Sequence
GCIKYGDRCGSPHGLPSNCCNDWKYKGRCGCTMGVCTCGPNCPSRGCDWSKKG
Modifications
Disulfide bond(4);
Length
53
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.