Home > Product > Catalog Peptides > Others > Urocortin II, mouse

Others

Urocortin II, mouse

[Price Inquiry]
CAT#
U02005
Sequence
VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2
M.W/Mr.
4153.0
Molecular Formula
C187H320N56O50
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.