Home > Product > Catalog Peptides > Others > Urocortin III, human

Others

warning All products are for research use only. Not for human use.

Urocortin III, human

[Price Inquiry]
CAT#
U02004
Sequence
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
M.W/Mr.
4137.93
Molecular Formula
C185H307N53O50S2
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.