Home > Product > Catalog Peptides > Others > Urocortin III, mouse, free acid

Others

Urocortin III, mouse, free acid

[Price Inquiry]
CAT#
U02006
Sequence
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI
M.W/Mr.
4174.0
Molecular Formula
C186H311N51O53S2
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.