Home > Product > Catalog Peptides > Others > Urocortin III, mouse, free acid

Others

Urocortin III, mouse, free acid

Price Inquiry
CAT#
U02006
Sequence
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI
M.W/Mr.
4174.0
Molecular Formula
C186H311N51O53S2
Length
38

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.