CAT# | U02006 |
M.F/Formula | C186H311N51O53S2 |
M.W/Mr. | 4174.0 |
Sequence | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI |
Length | 38 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X11949 | PM_3020040 | Inquiry | ||
X16763 | PM_9685382 | Inquiry | ||
X04888 | PM_11931705 | Inquiry | ||
X01273 | PH1PO004_05 | Inquiry | ||
X08282 | PM_16650071 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...