Home > Product > Catalog Peptides > Others > Urotensin I

Others

Urotensin I

[Price Inquiry]
CAT#
U03005
Sequence
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
M.W/Mr.
4869.1
Molecular Formula
C210H340N62O67S2
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.