Home > Product > Catalog Peptides > Others > Urotensin I

Others

Urotensin I

Price Inquiry
CAT#
U03005
Sequence
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
M.W/Mr.
4869.1
Molecular Formula
C210H340N62O67S2
Length
41

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.