β-Amyloid (1-42), (1-40), (1-46) and Fragments

[Val35]-beta-Amyloid (1-42)

[Price Inquiry]
CAT#
A13296
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLVVGGVVIA
M.W/Mr.
4482.1
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.