Home > Product > Catalog Peptides > Others > Vasoactive Intestinal peptide

Others

warning All products are for research use only. Not for human use.

Vasoactive Intestinal peptide

[Price Inquiry]
CAT#
V05002
Sequence
SDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
M.W/Mr.
3325.7
Molecular Formula
C147H238N44O42S
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.