Home > Product > Catalog Peptides > Others > Vasoactive Intestinal peptide

Others

Vasoactive Intestinal peptide

Price Inquiry
CAT#
V05002
Sequence
SDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
M.W/Mr.
3325.7
Molecular Formula
C147H238N44O42S
Length
27

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.