Keywords Search Google Search Search

Vejovine

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3334
Sequence	GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAASMTLDEIVDAMYYD
Activity	Gram-, Mammalian cells,

CAT#	Product Name	Inquiry
AF936	Nigrocin-1-OA2	Inquiry
AF1602	Bombinin-like peptides 1	Inquiry
AF008	Cyclopeptide E	Inquiry
AF990	Andersonin-S peptide precursor	Inquiry
AF1761	Odorranain-F1 antimicrobial peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Tripeptide-10 Citrulline, a substitute of decorin

An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...

Novel Peptide Drugs to Treat Multiple Diseases (Part Two)

5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

Myristoyl Octapeptide-1 promotes a healthy appearance of the skin

The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	the scorpion venom, Vaejovis mexicanus
Length	60