Home > Product > Antimicrobial Peptides > Vejovine

Antimicrobial Peptides

CAT#
AF3334
Sequence
GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAASMTLDEIVDAMYYD
Host Chemicals
the scorpion venom, Vaejovis mexicanus
Length
60
Activity
Gram-, Mammalian cells,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.