Home > Product > Antimicrobial Peptides > Vejovine

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3334
Sequence
GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAASMTLDEIVDAMYYD
Host Chemicals
the scorpion venom, Vaejovis mexicanus
Length
60
Activity
Gram-, Mammalian cells,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.