Home > Product > Catalog Peptides > Others > Vesicle - Associated Membrane Protein, VAMP (60 - 94)

Others

Vesicle - Associated Membrane Protein, VAMP (60 - 94)

[Price Inquiry]
CAT#
T09056
Sequence
LSELDDRADALQAGASQFETSAAKLKRKYWWKNLK
M.W/Mr.
4039.6
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.