Home > Product > Antimicrobial Peptides > Vhl-2

Antimicrobial Peptides

CAT#
AF1941
Sequence
GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
Host Chemicals
Viola hederacea
Length
30
Activity
Antiviral
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.