Home > Product > Antimicrobial Peptides > Vhl-1

Antimicrobial Peptides

CAT#
AF2061
Sequence
SISCGESCAMISFCFTEVIGCSCKNKVCYLN
Host Chemicals
Viola hederacea
Length
31
Activity
Antiviral
SwissProt ID
P84522
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.