Home > Product > Antimicrobial Peptides > Vibi F

Antimicrobial Peptides

CAT#
AF2039
Sequence
GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
Host Chemicals
Viola biflora
Length
31
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.