CAT# | AF2039 |
Sequence | GTIPCGESCVFIPCLTSALGCSCKSKVCYKN |
Activity | Antimicrobial |
Host Chemicals | Viola biflora | Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF189 | Pleurain-B1 antimicrobial peptide | Inquiry | ||
AF744 | Dybowskin-2CDYb | Inquiry | ||
AF2200 | Brevinin-2Ea | Inquiry | ||
AF291 | Preproalytesin-MA | Inquiry | ||
AF2598 | Esculentin-2V protein | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...