Keywords Search Google Search Search

Vibi G

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2037
Sequence	GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
Activity	Cancer cells

CAT#	Product Name	Inquiry
AF2759	Bacteriocin SRCAM 602	Inquiry
AF2511	Ostricacin-1	Inquiry
AF666	Nigroain-B1	Inquiry
AF2960	Beta-defensin 33	Inquiry
AF414	Antifungal protein Pr-2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The effect of terlipressin acetate in the treatment of decompensated liver cirrhosis

Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...

Abaloparatide Helps Osteoporotic Fractures Treatment

What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...

Function of linaclotide in irritable bowel syndrome

Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

Function of JIP1 in Promoting Axonal Growth

JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	alpine violet Viola biflora
Length	31