Home > Product > Antimicrobial Peptides > Vibi G

Antimicrobial Peptides

CAT#
AF2037
Sequence
GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
Host Chemicals
alpine violet Viola biflora
Length
31
Activity
Cancer cells
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.