Home > Product > Antimicrobial Peptides > Vicin-like antimicrobial peptide 2a

Antimicrobial Peptides

Vicin-like antimicrobial peptide 2a

[Price Inquiry]
CAT#
AF2456
Sequence
QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQE
Host Chemicals
Macadamia integrifolia
Length
35
Activity
Antibacterial, Antifungal
SwissProt ID
Q9SPL3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.