Home > Product > Catalog Peptides > Others > VIP (human, bovine, porcine, rat)

Others

warning All products are for research use only. Not for human use.

VIP (human, bovine, porcine, rat)

[Price Inquiry]
CAT#
V02016
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
M.W/Mr.
3325.84
Molecular Formula
C147H238N44O42S
Length
28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.