Home > Product > Catalog Peptides > Others > VIP (human, bovine, porcine, rat)

Others

VIP (human, bovine, porcine, rat)

Price Inquiry
CAT#
V02016
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
M.W/Mr.
3325.84
Molecular Formula
C147H238N44O42S
Length
28

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.