Home > Product > Antimicrobial Peptides > Viphi F

Antimicrobial Peptides

CAT#
AF2031
Sequence
GSIPCGESCVFIPCISAIIGCSCSSKVCYKN
Host Chemicals
Viola philippica
Length
31
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.