CAT# | AF2883 |
Sequence | GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH |
Activity | Antibacterial |
Host Chemicals | Heliothis virescens | Length | 41 | SwissProt ID | P83416 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF384 | MB-21 | Inquiry | ||
AF310 | Japonicin-1 | Inquiry | ||
AF1878 | Epilancin 15X | Inquiry | ||
AF1835 | Cathelin-related peptide SC5 | Inquiry | ||
AF2531 | Raphanus Sativus Antifungal Protein 2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...