Home > Product > Antimicrobial Peptides > VIRE_HELVI Virescein

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

VIRE_HELVI Virescein

[Price Inquiry]
CAT#
AF2883
Sequence
GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH
Host Chemicals
Heliothis virescens
Length
41
Activity
Antibacterial
SwissProt ID
P83416
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.